| Research Topic | Others |
| Uniprot ID | P0DTD1/YP_009742616.1 |
| Gene Names | Nsp9 |
| Organism | Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV) |
| AA Sequence | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Expression Region | 1-113aa |
| Sequence Info | Full length |
| Source | Mammalian cell |
| Tag Info | C-terminal hFc-Flag-tagged |
| MW | 44.5 kDa |
| Lead Time | 3-? business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Biological Activity | N/A |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Not test. |