Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)


Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9)

Cat No:HR4S1217
Product available

  Product info

Type: Proteins
Product Details

Research TopicOthers
Uniprot IDP0DTD1/YP_009742616.1
Gene NamesNsp9
OrganismHuman Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
AA SequenceNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Expression Region1-113aa
Sequence InfoFull length
SourceE.coli
Tag InfoC-terminal 10xHis-tagged
MW13.9 kDa
Lead Time3-? business days
Distributor Price 2100ug
PurityGreater than 90% as determined by SDS-PAGE.
Biological ActivityN/A
Storage BufferIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Endotoxin Not test.

Write us

Superfast Delivery
Customer Support
Secure Online Payment
website designing in delhi website development company in delhi website developers in delhi freelancer website designer in delhi india best website development company in delhi