| Research Topic | Microbiology |
| Uniprot ID | P59594 |
| Gene Names | S |
| Organism | Severe acute respiratory syndrome coronavirus (SARS-CoV) |
| AA Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
| Expression Region | 306-527aa |
| Sequence Info | Partial |
| Source | Mammalian cell |
| Tag Info | C-terminal 6xHis-tagged |
| MW | 27.2 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Biological Activity | N/A |
| Storage Buffer | Lyophilized from a 0.2 ?m sterile fiiltered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |