| Research Topic | Others |
| Uniprot ID | P36334 |
| Gene Names | S |
| Organism | Human coronavirus OC43 (HCoV-OC43) |
| AA Sequence | VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK |
| Expression Region | 15-344aa |
| Sequence Info | Partial |
| Source | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| MW | 53.6 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Biological Activity | N/A |
| Storage Buffer | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Not test. |