Research Topic | Others |
Uniprot ID | P36334 |
Gene Names | S |
Organism | Human coronavirus OC43 (HCoV-OC43) |
AA Sequence | VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK |
Expression Region | 15-344aa |
Sequence Info | Partial |
Source | Yeast |
Tag Info | N-terminal 6xHis-tagged |
MW | 39.6 kDa |
Lead Time | 3-7 business days |
Distributor Price 2 | 100ug |
Purity | Greater than 90% as determined by SDS-PAGE. |
Biological Activity | N/A |
Storage Buffer | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
Endotoxin | Not test. |