| Research Topic | Immunology |
| Uniprot ID | P0DTC4 & P0DTC5 |
| Gene Names | E & M |
| Organism | Severe acute respiratory syndrome coronavirus 2 |
| AA Sequence | MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG |
| Expression Region | 1-42aa |
| Sequence Info | Partial |
| Source | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| MW | 17.6 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Biological Activity | N/A |
| Storage Buffer | Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Not test. |