Research Topic | Others |
Uniprot ID | Q5MQC9 |
Gene Names | 4 |
Organism | Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) |
AA Sequence | MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG |
Expression Region | 1-109aa |
Sequence Info | Full Length |
Source | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW | 20.0 kDa |
Lead Time | 3-7 business days |
Distributor Price 2 | 100ug |
Purity | Greater than 85% as determined by SDS-PAGE. |
Biological Activity | N/A |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
Endotoxin | Not test. |