Research Topic | Microbiology |
Uniprot ID | Q8V436 |
Gene Names | S |
Organism | Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV) |
AA Sequence | TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDHCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY |
Expression Region | 314-634aa |
Sequence Info | Partial |
Source | Mammalian cell |
Tag Info | C-terminal 6xHis-tagged |
MW | 37.3 kDa |
Lead Time | 3-7 business days |
Distributor Price 2 | 100ug |
Purity | Greater than 85% as determined by SDS-PAGE. |
Biological Activity | N/A |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
Endotoxin | Not test. |