Research Topic | Microbiology |
Uniprot ID | Q3LZX1 |
Gene Names | S |
Organism | Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3) |
AA Sequence | RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF |
Expression Region | 310-514aa |
Sequence Info | Partial |
Source | E.coli |
Tag Info | N-terminal 6xHis-tagged |
MW | 25.9 kDa |
Lead Time | 3-7 business days |
Distributor Price 2 | 100ug |
Purity | Greater than 90% as determined by SDS-PAGE. |
Biological Activity | N/A |
Storage Buffer | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
Endotoxin | Not test. |