| Research Topic | Microbiology |
| Uniprot ID | P0DTC2 |
| Gene Names | S |
| Organism | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| AA Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Expression Region | 319-541aa (V483A) |
| Sequence Info | Partial |
| Source | Mammalian cell |
| Tag Info | C-terminal 10xHis-tagged |
| MW | 27.8 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Biological Activity | ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 ?g/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 196.4-272.1 ng/ml. ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 ?g/ml can bind SARS-CoV-2-S Antibody (CSB-RA33245A1GMY), the EC50 is 7.481- 18.76 ng/ml. |
| Storage Buffer | Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |