Research Topic | Microbiology |
Uniprot ID | P0DTC2 |
Gene Names | S |
Organism | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
AA Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Expression Region | 319-541aa(N501Y) |
Sequence Info | Partial |
Source | Mammalian cell |
Tag Info | C-terminal 10xHis-tagged |
MW | 27.9 kDa |
Lead Time | 3-7 business days |
Distributor Price 2 | 100ug |
Purity | Greater than 90% as determined by SDS-PAGE. |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (N501Y) at 2 ?g/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 12.95-17.87 ng/ml. |
Storage Buffer | Lyophilized from a 0.2 ?m sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |