| Research Topic | Others |
| Uniprot ID | P0DTC2 |
| Gene Names | S |
| Organism | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| AA Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Expression Region | 319-541aa(E484K) |
| Sequence Info | Partial |
| Source | Mammalian cell |
| Tag Info | C-terminal mFc-tagged |
| MW | 54.4 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Biological Activity | ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 ?g/ml can bind human ACE2 (CSB-MP866317HU-B), the EC50 is 6.597-8.187 ng/ml. ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 ?g/ml can bind Biotin-S Antibody (CSB-RA33245D1GMY), the EC50 is 21.54-26.77 ng/ml. |
| Storage Buffer | Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |