| Research Topic | Biochemicals |
| Uniprot ID | O15393 |
| Gene Names | TMPRSS2 |
| Organism | Homo sapiens (Human) |
| AA Sequence | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| Expression Region | 106-492aa (R255Q) |
| Sequence Info | Partial |
| Source | Mammalian cell |
| Tag Info | N-terminal 10xHis-tagged |
| MW | 46.4 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Biological Activity | ?Recombinant Human TMPRSS2 His tag protein (CSB-MP023924HU(M)b0) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 19.16?M. ?Measured by Bromhexine Hydrochloride inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Bromhexine Hydrochloride inhibit EC50 is 81.79-154.2?M. ?Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.005877- 0.01293?M. |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Not test. |