| Research Topic | Cancer |
| Uniprot ID | P59594 |
| Gene Names | S |
| Organism | Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus) |
| AA Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
| Expression Region | 306-527aa |
| Sequence Info | Extracellular domain |
| Source | Mammalian cell |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| MW | 30 kDa |
| Lead Time | 3-7 business days |
| Distributor Price 2 | 100ug |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Biological Activity | ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 ?g/ml can bind Paguma larvata ACE2 (CSB-MP684964PAL), the EC50 is 5.056-7.559 ng/ml.?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 ?g/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 7.941-10.49 ng/ml. |
| Storage Buffer | Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |